PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039325
Common NameLOC102604580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 137aa    MW: 14927.5 Da    PI: 6.5213
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039325genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB167.32e-5221116297
                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                           reqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvtseasdkc++e+rkt+ngdd++wal+tlGf+dy  +lk yl++y
  PGSC0003DMP400039325  21 REQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTSEASDKCRKERRKTVNGDDVCWALGTLGFDDYGGALKRYLHRY 109
                           89*************************************************************************************** PP

                 NF-YB  91 relegek 97 
                           re egek
  PGSC0003DMP400039325 110 RESEGEK 116
                           ****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.9E-5016126IPR009072Histone-fold
SuperFamilySSF471135.48E-3823130IPR009072Histone-fold
PfamPF008081.7E-262690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.0E-155472No hitNo description
PRINTSPR006151.0E-157391No hitNo description
PRINTSPR006151.0E-1592110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MSQQNIGGAS SSNDEGAGSS REQDRLLPIA NVGRIMKNIL PPNAKISKEA KETMQECVSE  60
FIGFVTSEAS DKCRKERRKT VNGDDVCWAL GTLGFDDYGG ALKRYLHRYR ESEGEKVNQE  120
QAGGGSGSHQ PRNYLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4421111292Transcription factor HapC (Eurofung)
4g92_B5e-4421111292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006342784.11e-98PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822486e-60NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM1C2L22e-98M1C2L2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000584145e-98(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-61nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]